Recombinant Mouse TET2 Protein (1810-1912 aa), His-KSI-tagged

• Cat.No.: TET2-2683M
• Product Overview: Recombinant Mouse TET2 Protein (1810-1912 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-KSI tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&KSI
• ProteinLength: 1810-1912 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.0 kDa
• AA Sequence: RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Tet2 tet methylcytosine dioxygenase 2 [ Mus musculus ]
• Official Symbol: TET2
• Synonyms: TET2; tet methylcytosine dioxygenase 2; tet oncogene 2; Ayu17-449; mKIAA1546; E130014J05Rik; MGC37385
• Gene ID: 214133
• mRNA Refseq: NM_001040400
• Protein Refseq: NP_001035490
• UniProt ID: Q4JK59