Recombinant Mouse Tdo2 protein, His-tagged

• Cat.No.: Tdo2-3559M
• Product Overview: Recombinant Mouse Tdo2 protein(P48776)(1-406aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-406aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.3 kDa
• AA Sequence: MSGCPFAGNSVGYTLKNVSMEDNEEDRAQTGVNRASKGGLIYGNYLQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPNGFNFWGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRHDYLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGTKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLYTAEYSDSSYFSSDESD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Tdo2 tryptophan 2,3-dioxygenase [ Mus musculus ]
• Official Symbol: Tdo2
• Synonyms: TDO2; tryptophan 2,3-dioxygenase; TRPO; tdo variant1; tdo variant2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; tryptophan-2,3-dioxygenase; TO; TDO; chky; AA407491
• Gene ID: 56720
• mRNA Refseq: NM_019911
• Protein Refseq: NP_064295