Recombinant Human TDO2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TDO2-6516H
• Product Overview: TDO2 MS Standard C13 and N15-labeled recombinant protein (NP_005642) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 47.9 kDa
• AA Sequence: MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TDO2 tryptophan 2,3-dioxygenase [ Homo sapiens (human) ]
• Official Symbol: TDO2
• Synonyms: TDO2; tryptophan 2,3-dioxygenase; TDO; TPH2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; TO; TRPO
• Gene ID: 6999
• mRNA Refseq: NM_005651
• Protein Refseq: NP_005642
• MIM: 191070
• UniProt ID: P48775