Recombinant Human TDO2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TDO2-6516H |
Product Overview : | TDO2 MS Standard C13 and N15-labeled recombinant protein (NP_005642) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TDO2 tryptophan 2,3-dioxygenase [ Homo sapiens (human) ] |
Official Symbol | TDO2 |
Synonyms | TDO2; tryptophan 2,3-dioxygenase; TDO; TPH2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; TO; TRPO; |
Gene ID | 6999 |
mRNA Refseq | NM_005651 |
Protein Refseq | NP_005642 |
MIM | 191070 |
UniProt ID | P48775 |
◆ Recombinant Proteins | ||
TDO25033H | Recombinant Human TDO2 (39-389) Protein | +Inquiry |
TDO2-16601M | Recombinant Mouse TDO2 Protein | +Inquiry |
Tdo2-3559M | Recombinant Mouse Tdo2 protein, His-tagged | +Inquiry |
TDO2-3408H | Recombinant Human TDO2 protein, His-tagged | +Inquiry |
TDO2-5997R | Recombinant Rat TDO2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDO2-1156HCL | Recombinant Human TDO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TDO2 Products
Required fields are marked with *
My Review for All TDO2 Products
Required fields are marked with *
0
Inquiry Basket