Recombinant Mouse Tcl1a protein, His&Myc-tagged
Cat.No. : | Tcl1a-743M |
Product Overview : | Recombinant Mouse Tcl1a protein(P56280)(1-116aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-116a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MATQRAHRAETPAHPNRLWIWEKHVYLDEFRRSWLPVVIKSNEKFQVILRQEDVTLGEAMSPSQLVPYELPLMWQLYPKDRYRSCDSMYWQILYHIKFRDVEDMLLELIDSESNDE |
◆ Recombinant Proteins | ||
TCL1A-6613H | Recombinant Human TCL1A Protein (Met1-Asp114), N-His tagged | +Inquiry |
TCL1A-30569TH | Recombinant Human TCL1A | +Inquiry |
Tcl1a-2119R | Recombinant Rat Tcl1a Protein, His-tagged | +Inquiry |
TCL1A-3160H | Recombinant Human TCL1A, GST-tagged | +Inquiry |
Tcl1a-743M | Recombinant Mouse Tcl1a protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCL1A-1174HCL | Recombinant Human TCL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tcl1a Products
Required fields are marked with *
My Review for All Tcl1a Products
Required fields are marked with *
0
Inquiry Basket