Recombinant Mouse Stc2 Protein, 25-296aa, C-His tagged

• Cat.No.: STC2-16118M
• Product Overview: Recombinant Mouse Stc2 Protein (25-296aa) with C-His tag was expressed in hek293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 25-296aa
• Description: Predicted to enable enzyme binding activity; heme binding activity; and protein homodimerization activity. Acts upstream of or within several processes, including cellular calcium ion homeostasis; endoplasmic reticulum unfolded protein response; and regulation of store-operated calcium entry. Located in Golgi apparatus and endoplasmic reticulum. Is expressed in several structures, including embryo mesenchyme; genitourinary system; gut; olfactory epithelium; and vertebral axis musculature. Orthologous to human STC2 (stanniocalcin 2).
• Form: Liquid
• Molecular Mass: Theoretical molecular weight: ~ 30 kDa including His tag.
• AA Sequence: TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRRHHHHHH
• Purity: > 90% as determined by SDS-PAGE
• Storage: Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.72 mg/mL
• Storage Buffer: PBS, pH 7.4
• Publications:
  Histidine-Rich Glycoprotein and Stanniocalcin-2 High Affinity Interactions with Inflammatory Cells (2022)
  Quartz Crystal Microbalance Measurement of Histidine-Rich Glycoprotein and Stanniocalcin-2 Binding to Each Other and to Inflammatory Cells (2021)
  Leukocyte differentiation by histidine-rich glycoprotein/stanniocalcin-2 complex regulates murine glioma growth through modulation of antitumor immunity (2018)

Gene Information

• Gene Name: Stc2 stanniocalcin 2 [ Mus musculus (house mouse) ]
• Official Symbol: Stc2
• Synonyms: Stc2; stanniocalcin 2; Stc-2; Stc2l; mustc2; stanniocalcin-2
• Gene ID: 20856
• mRNA Refseq: NM_011491
• Protein Refseq: NP_035621
• UniProt ID: O88452