Recombinant Mouse SRY Protein (1-144 aa), His-tagged
Cat.No. : | SRY-819M |
Product Overview : | Recombinant Mouse SRY Protein (1-144 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-144 aa |
Description : | Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons . Involved in different aspects of gene regulation including promoter activation or repression. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Promotes DNA bending. Also involved in pre-mRNA splicing . Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'.1 Publication. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 21.2 kDa |
AA Sequence : | MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Sry sex determining region of Chr Y [ Mus musculus ] |
Official Symbol | SRY |
Synonyms | SRY; Tdf; Tdy; MGC129295; |
Gene ID | 21674 |
mRNA Refseq | NM_011564 |
Protein Refseq | NP_035694 |
UniProt ID | Q05738 |
◆ Recombinant Proteins | ||
SRY-454H | Recombinant Human SRY Protein, His-tagged | +Inquiry |
SRY-819M | Recombinant Mouse SRY Protein (1-144 aa), His-tagged | +Inquiry |
SRY-4296R | Recombinant Rhesus Macaque SRY Protein, His (Fc)-Avi-tagged | +Inquiry |
SRY-8738M | Recombinant Mouse SRY Protein, His (Fc)-Avi-tagged | +Inquiry |
SRY-16019M | Recombinant Mouse SRY Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRY-1469HCL | Recombinant Human SRY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRY Products
Required fields are marked with *
My Review for All SRY Products
Required fields are marked with *
0
Inquiry Basket