Recombinant Mouse SPRR2B Protein (1-98 aa), His-Myc-tagged

Cat.No. : SPRR2B-2752M
Product Overview : Recombinant Mouse SPRR2B Protein (1-98 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His&Myc
Protein Length : 1-98 aa
Description : Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.7 kDa
AA Sequence : MSYYQQQCKQPCQPPPVCPPPKCPEPCPPPKCPEPCPPPVCCEPCPPPKCPEPCPPPVCCEPCPPPVCCEPCPPQPWQPKCPPVQFPPCQQKCPPKNK
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Sprr2b small proline-rich protein 2B [ Mus musculus (house mouse) ]
Official Symbol SPRR2B
Synonyms Sprr2b;
Gene ID 20756
UniProt ID O70554

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SPRR2B Products

Required fields are marked with *

My Review for All SPRR2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon