Recombinant Human SPRR2B Protein (1-72 aa), His-Myc-tagged

• Cat.No.: SPRR2B-2219H
• Product Overview: Recombinant Human SPRR2B Protein (1-72 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His&Myc
• Protein Length: 1-72 aa
• Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.0 kDa
• AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: SPRR2B small proline rich protein 2B [ Homo sapiens (human) ]
• Official Symbol: SPRR2B
• Synonyms: SPRR2B
• Gene ID: 6701
• mRNA Refseq: NM_001017418
• Protein Refseq: NP_001017418
• UniProt ID: P35325