Recombinant Mouse SPINK1 Protein (24-80 aa), GST-tagged

• Cat.No.: SPINK1-960M
• Product Overview: Recombinant Mouse SPINK1 Protein (24-80 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Description: Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.
• Source: E. coli
• Species: Mouse
• Tag: GST
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 33.1 kDa
• Protein length: 24-80 aa
• AA Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• UniProt ID: P09036