Recombinant Mouse SPINK1 Protein (24-80 aa), His-tagged

• Cat.No.: SPINK1-1623M
• Product Overview: Recombinant Mouse SPINK1 Protein (24-80 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Description: Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa.
• Source: Yeast
• Species: Mouse
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 8.1 kDa
• Protein length: 24-80 aa
• AA Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Spink1 serine peptidase inhibitor, Kazal type 1 [ Mus musculus (house mouse) ]
• Official Symbol: SPINK1
• Synonyms: p12; Spink3
• Gene ID: 20730
• mRNA Refseq: NM_009258
• Protein Refseq: NP_033284
• UniProt ID: P09036