Recombinant Mouse SMURF1 protein, His-tagged

• Cat.No.: SMURF1-4325H
• Product Overview: Recombinant Mouse SMURF1 protein(Q9HCE7)(198-374aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: His
• Protein length: 198-374aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.1 kDa
• AASequence: VESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Smurf1 SMAD specific E3 ubiquitin protein ligase 1 [ Mus musculus ]
• Official Symbol: SMURF1
• Synonyms: SMURF1; SMAD specific E3 ubiquitin protein ligase 1; E3 ubiquitin-protein ligase SMURF1; Smad ubiquitination regulatory factor 1; SMAD-specific E3 ubiquitin-protein ligase 1; mKIAA1625; 4930431E10Rik
• Gene ID: 75788
• mRNA Refseq: NM_001038627
• Protein Refseq: NP_001033716