Recombinant Mouse Serpinf1 Protein
Cat.No. : | Serpinf1-139M |
Product Overview : | Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade F, member 1 (Serpinf1) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. |
Molecular Mass : | 42 kDa |
AA Sequence : | MDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLTMIEESLTSEF |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Serpinf1 serine (or cysteine) peptidase inhibitor, clade F, member 1 [ Mus musculus (house mouse) ] |
Official Symbol | Serpinf1 |
Synonyms | Serpinf1; serine (or cysteine) peptidase inhibitor, clade F, member 1; Pedf; Sdf3; EPC-1; Pedfl; AI195227; pigment epithelium-derived factor; SDF-3; alpha-2 antiplasmin; caspin; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; serine (or cysteine) proteinase inhibitor, clade F), member 1; serine (or cysteine) proteinase inhibitor, clade F, member 1; serpin F1; stromal cell-derived factor 3 |
Gene ID | 20317 |
mRNA Refseq | NM_011340 |
Protein Refseq | NP_035470 |
UniProt ID | P97298 |
◆ Recombinant Proteins | ||
Serpinf1-85H | Recombinant Mouse Serpinf1 | +Inquiry |
SERPINF1-378H | Active Recombinant Full Length Human SERPINF1, His-tagged | +Inquiry |
SERPINF1-2968H | Recombinant Human SERPINF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINF1-25H | Recombinant Human SERPINF1, FLAG-tagged | +Inquiry |
Serpinf1-5792M | Recombinant Mouse Serpinf1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINF1-2500HCL | Recombinant Human SERPINF1 cell lysate | +Inquiry |
SERPINF1-2673MCL | Recombinant Mouse SERPINF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Serpinf1 Products
Required fields are marked with *
My Review for All Serpinf1 Products
Required fields are marked with *
0
Inquiry Basket