Recombinant Mouse Serpinf1
Cat.No. : | Serpinf1-85H |
Product Overview : | Recombinant Mouse Pigment epithelium-derived factor/SERPIN F1 is produced with our E. coli expression system. The target protein is expressed with sequence (Asp43-Thr417 ) of Mouse SERPIN F1. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 43-417 a.a. |
Description : | Serpin F1 is secreted Neurotrophic protein and belongs to the serpin family. Serpin F1 Highly expressed in the liver, gastric glandular mucosa and renal tubules. It is also expressed in the brain, heart, lung retina and testes. It induces extensive neuronal differentiation in retinoblastoma cells. It is potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, exhibits no serine protease inhibitory activity. |
Form : | Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4 |
AA Sequence : | MDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRA LYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTRPRILTGN PRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDR TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLTMIEESLTSEFIHDID RELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITGKPVKLTQVEHRAAFEWNEE GAGSSPSPGLQPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDPSST |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 5 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 3X PBS.Please aliquot the reconstituted solution. |
Gene Name | SERPINF1 serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 [ Homo sapiens ] |
Official Symbol | Serpinf1 |
Synonyms | SERPINF1; serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; PEDF, serine (or cysteine) proteinase inhibitor, clade F (alpha 2 antiplasmin, pigment epithelium derived factor), member 1; pigment epithelium-derived factor; EPC 1; PIG35; pigment epithelium derived factor; proliferation inducing protein 35; serpin F1; cell proliferation-inducing gene 35 protein; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1; OI6; OI12; PEDF; EPC-1; |
Gene ID | 5176 |
mRNA Refseq | NM_002615 |
Protein Refseq | NP_002606 |
MIM | 172860 |
UniProt ID | P36955 |
Chromosome Location | 17p13.3 |
Function | serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
SERPINF1-1000H | Recombinant Human SERPINF1 Protein, MYC/DDK-tagged | +Inquiry |
SERPINF1-2343H | Recombinant Human SERPINF1 protein, His-tagged | +Inquiry |
SERPINF1-2968H | Recombinant Human SERPINF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINF1-656C | Recombinant Cynomolgus Monkey SERPINF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINF1-2149HFL | Recombinant Full Length Human SERPINF1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINF1-2500HCL | Recombinant Human SERPINF1 cell lysate | +Inquiry |
SERPINF1-2673MCL | Recombinant Mouse SERPINF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Serpinf1 Products
Required fields are marked with *
My Review for All Serpinf1 Products
Required fields are marked with *
0
Inquiry Basket