Recombinant Mouse Sag protein, His-tagged
Cat.No. : | Sag-3469M |
Product Overview : | Recombinant Mouse Sag protein(P20443)(1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-403aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.4 kDa |
AA Sequence : | MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLKDTGENTEGKKDEDAGQDE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Sag retinal S-antigen [ Mus musculus ] |
Official Symbol | Sag |
Synonyms | SAG; retinal S-antigen; S-arrestin; S-AG; arrestin 1; rod arrestin; 48 kDa protein; visual arrestin 1; rod photoreceptor arrestin; Arr1; Irbp; arrestin; A930001K18Rik; |
Gene ID | 20215 |
mRNA Refseq | NM_009118 |
Protein Refseq | NP_033144 |
◆ Recombinant Proteins | ||
SAG-4884R | Recombinant Rat SAG Protein, His (Fc)-Avi-tagged | +Inquiry |
SAG-3766H | Recombinant Human SAG protein, His-tagged | +Inquiry |
Sag-3469M | Recombinant Mouse Sag protein, His-tagged | +Inquiry |
SAG-1365H | Recombinant Human SAG Protein, His-tagged | +Inquiry |
SAG-301320H | Recombinant Human SAG protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sag Products
Required fields are marked with *
My Review for All Sag Products
Required fields are marked with *
0
Inquiry Basket