Recombinant Mouse S100a5 Protein, His-tagged

• Cat.No.: S100a5-7325M
• Product Overview: Recombinant mouse S100A5 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-93
• Description: Binds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites.
• Form: Liquid
• Molecular Mass: 13.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer, pH 8.0, 40 % glycerol, 3 mM DTT, 200 mM NaCl

Gene Information

• Gene Name: S100a5 S100 calcium binding protein A5 [ Mus musculus (house mouse) ]
• Official Symbol: S100a5
• Synonyms: S100a5; S100 calcium binding protein A5; S100D; S100D9; protein S100-A5
• Gene ID: 20199
• mRNA Refseq: NM_011312
• Protein Refseq: NP_035442
• UniProt ID: P63084