Recombinant Human S100A5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A5-5408H
• Product Overview: S100A5 MS Standard C13 and N15-labeled recombinant protein (NP_002953) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions. This protein also binds Zn2+ and Cu2+, and Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the adult brain.
• Molecular Mass: 12.8 kDa
• AA Sequence: MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A5 S100 calcium binding protein A5 [ Homo sapiens (human) ]
• Official Symbol: S100A5
• Synonyms: S100A5; S100 calcium binding protein A5; S100 calcium binding protein A5, S100D; protein S100-A5; S100 calcium-binding protein A5; S100D
• Gene ID: 6276
• mRNA Refseq: NM_002962
• Protein Refseq: NP_002953
• MIM: 176991
• UniProt ID: P33763