Recombinant Mouse QPCT Protein (36-362 aa), His-tagged
Cat.No. : | QPCT-2139M |
Product Overview : | Recombinant Mouse QPCT Protein (36-362 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 36-362 aa |
Description : | Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 41.6 kDa |
AA Sequence : | AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Qpct glutaminyl-peptide cyclotransferase (glutaminyl cyclase) [ Mus musculus ] |
Official Symbol | QPCT |
Synonyms | QPCT; QC; glutaminyl cyclase; 5730422A13Rik; |
Gene ID | 70536 |
mRNA Refseq | NM_027455 |
Protein Refseq | NP_081731 |
UniProt ID | Q9CYK2 |
◆ Recombinant Proteins | ||
QPCT-1822H | Recombinant Human QPCT Protein, His (Fc)-Avi-tagged | +Inquiry |
QPCT-322HFL | Recombinant Full Length Human QPCT Protein, C-Flag-tagged | +Inquiry |
Qpct-5056M | Recombinant Mouse Qpct protein, His-tagged | +Inquiry |
QPCT-5790H | Recombinant Human QPCT Protein (Val29-Leu361), His tagged | +Inquiry |
QPCT-2139M | Recombinant Mouse QPCT Protein (36-362 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
QPCT-001HCL | Recombinant Human QPCT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All QPCT Products
Required fields are marked with *
My Review for All QPCT Products
Required fields are marked with *
0
Inquiry Basket