Recombinant Mouse QPCT Protein (36-362 aa), His-tagged

• Cat.No.: QPCT-2139M
• Product Overview: Recombinant Mouse QPCT Protein (36-362 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.

Specification

• Description: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 41.6 kDa
• Protein length: 36-362 aa
• AA Sequence: AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Qpct glutaminyl-peptide cyclotransferase (glutaminyl cyclase) [ Mus musculus ]
• Official Symbol: QPCT
• Synonyms: QPCT; QC; glutaminyl cyclase; 5730422A13Rik
• Gene ID: 70536
• mRNA Refseq: NM_027455
• Protein Refseq: NP_081731
• UniProt ID: Q9CYK2