Recombinant Mouse PTK7 Protein, His and Myc tagged
Cat.No. : | PTK7-13660M |
Product Overview : | Recombinant Mouse PTK7 Protein with His and Myc tag was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Description : | Predicted to enable cell adhesion molecule binding activity. Acts upstream of or within several processes, including animal organ development; axis elongation; and morphogenesis of an epithelium. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system; nervous system; paraxial mesenchyme; reproductive system; and sensory organ. Orthologous to human PTK7 (protein tyrosine kinase 7 (inactive)). |
Source : | E. coli |
Species : | Mouse |
Tag : | His and Myc |
Molecular Mass : | 79 kDa |
AA Sequence : | AVDRLQDSGAFQCVARDNVTGEEVRSTNASFNIKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDDQSTHTVSSRERNLTLRPASPEHSGLYSCCAHNAFGQACSSQNFTLSVADESFARVVLAPQDVVVARNEEAMFHCQFSAQPPPSLQWVFEDETPITNRSRPPHLRRAVVFANGSLLLTQVRPRNAGVYRCIGQGQRGPPIVLEATLHLAEIEDMLPFEPRVFIAGDEERVTCPAPQGLPTPSVWWEHAGVPLPAHGRVHQKGLELVFVTIAESDTGVYTCHASNLAGQRRQDVNITVATVPTWLRKPQDSQLEEGKPGYLHCLTQATPKPTVIWYRNQMLISEDSRFEVSKNGTLRINSVEVYDGTLYRCVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTVKWVRADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNEPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLRCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGSYTCIAGNSCNIRHTEAPLLVVDKPVMEDSEGPGSPPPYKMIQT |
Endotoxin : | < 1.0 EU/μg of the protein as determined by the LAL method. |
Purity : | > 90% by SDS-PAGE |
Stability : | Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
Storage : | Store it under sterile conditions at -20 to -70 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from sterile 20mM Tris-HCl, 500mM NaCl, pH8.0. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 μg/μL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
Gene Name | Ptk7 PTK7 protein tyrosine kinase 7 [ Mus musculus (house mouse) ] |
Official Symbol | PTK7 |
Synonyms | PTK7; PTK7 protein tyrosine kinase 7; inactive tyrosine-protein kinase 7; protein chuzhoi; protein-tyrosine kinase 7; tyrosine-protein kinase-like 7; pseudo tyrosine kinase receptor 7; receptor tyrosine kinase-like protein; chz; mPTK7/CCK4; 8430404F20Rik; |
Gene ID | 71461 |
mRNA Refseq | NM_175168 |
Protein Refseq | NP_780377 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PTK7 Products
Required fields are marked with *
My Review for All PTK7 Products
Required fields are marked with *
0
Inquiry Basket