Recombinant Mouse Prnp Protein

• Cat.No.: Prnp-289M
• Product Overview: Recombinant Mouse Prnp(23-231 aa) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• ProteinLength: 23-231 aa
• Description: Prion Protein (PrP) is an abundant cellular protein in mammalian neural tissue. It is associated with mammalian prion diseases, e.g. transmissible spongiforme encephalophathies that include human Creutzfeld-Jakob disease, bovine spongiforme encephalopathy, sheep scrapie, cervid’s chronic wasting disease and various rodent prion diseases. In the disease process, PrP undergoes protein aggregation into disease specific PrPSc.
• Form: Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 0.25 mg/ml.
• Molecular Mass: 23163 kg/mol
• AA Sequence: GSKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWED
  RYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSS
• Purity: > 95% by SDS-PAGE
• Applications: Prion Protein is frequently used in analytical aggregation assays
• Notes: Thawing: Gentle agitation at 37 centigrade until no ice is left. Keep on ice. Do not refreeze
• Storage: Store at -80 centigrade
• Concentration: 0.25 mg/ml

Gene Information

• Gene Name: Prnp prion protein [ Mus musculus ]
• Official Symbol: Prnp
• Synonyms: PRNP; prion protein; major prion protein; PrP; PrPC; Sinc; CD230; PrPSc; Prn-i; Prn-p; PrP< C> AA960666; AI325101; prP27-30; prP33-35C
• Gene ID: 19122
• mRNA Refseq: NM_011170
• Protein Refseq: NP_035300
• UniProt ID: P04925