Recombinant Cervus elaphus PRNP Protein, His-tagged

• Cat.No.: PRNP-40C
• Product Overview: Recombinant Cervus elaphus PRNP Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Cervus elaphus
• Source: E.coli
• Tag: His
• Description: prion protein
• Form: Supplied as a 0.2 μm filtered solution in PBS, pH8.0.
• Molecular Mass: ~17.3KDa
• AA Sequence: MGGGWGQGGTHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQLEHHHHHH
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.11mg/mL

Gene Information

• Gene Name: LOC122681498 prion protein [ Cervus elaphus (red deer) ]
• Official Symbol: PRNP
• Synonyms: PrP; PRNP
• Gene ID: 122681498
• mRNA Refseq: XM_043883659
• Protein Refseq: XP_043739594
• UniProt ID: P47852