Recombinant Mouse Pld3 Full Length Transmembrane protein, His-tagged

• Cat.No.: Pld3-2388M
• Product Overview: Recombinant Mouse Pld3 protein(O35405)(1-488aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-488aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 58.2 kDa
• AA Sequence: MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Pld3 phospholipase D family, member 3 [ Mus musculus ]
• Official Symbol: Pld3
• Synonyms: PLD3; phospholipase D family, member 3; phospholipase D3; PLD 3; choline phosphatase 3; schwannoma-associated protein 9; phosphatidylcholine-hydrolyzing phospholipase D3; Sam-9
• Gene ID: 18807
• mRNA Refseq: NM_011116
• Protein Refseq: NP_035246