Recombinant Human PLD3, GST-tagged
Cat.No. : | PLD3-105H |
Product Overview : | Recombinant Human PLD3(1 a.a. - 490 a.a.) , fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 81.1 kDa |
AA Sequence : | MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPA PCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQ LQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLT QVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAYLASAPPPLC PSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLRRATYERGVKVRLLISCWGHSEPSMR AFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYMVTERATYIGTSNWSGNYFTETAGTSLLVTQ NGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PLD3 phospholipase D family, member 3 [ Homo sapiens (human) ] |
Official Symbol | PLD3 |
Synonyms | PLD3; HUK4; HU-K4; phospholipase D family, member 3; hospholipase D3; PLD 3; hindIII K4L homolog; choline phosphatase 3; phosphatidylcholine-hydrolyzing phospholipase D3; NP_001026866.1; EC 3.1.4.4; NP_036400.2 |
Gene ID | 23646 |
mRNA Refseq | NM_001031696 |
Protein Refseq | NP_001026866 |
MIM | 615698 |
UniProt ID | Q8IV08 |
Chromosome Location | 19q13.2 |
Pathway | Ether lipid metabolism; Glycerophospholipid biosynthesis; Phospholipid metabolism |
Function | NAPE-specific phospholipase D activity; phospholipase D activity; protein binding |
◆ Recombinant Proteins | ||
Lama5-217M | Recombinant Mouse Lama5 Protein, His-tagged | +Inquiry |
NAIF1-3895HF | Recombinant Full Length Human NAIF1 Protein, GST-tagged | +Inquiry |
PEDINA-P17-4588S | Recombinant Staphylococcus aureus (strain: E-1) PEDINA_P17 protein, His-tagged | +Inquiry |
CASP6-2754M | Recombinant Mouse CASP6 Protein | +Inquiry |
ATP5G3-458R | Recombinant Rhesus monkey ATP5G3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1752A | Active Native Aleuria Aurantia Lectin Protein, Biotinylated | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Rectum-54H | Human Rectum Tumor Tissue Lysate | +Inquiry |
Fetal Spleen-167H | Human Fetal Spleen Membrane Lysate | +Inquiry |
MAFA-4562HCL | Recombinant Human MAFA 293 Cell Lysate | +Inquiry |
C2orf88-8058HCL | Recombinant Human C2orf88 293 Cell Lysate | +Inquiry |
IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLD3 Products
Required fields are marked with *
My Review for All PLD3 Products
Required fields are marked with *
0
Inquiry Basket