Recombinant Mouse Pkdcc protein, His&Myc-tagged
Cat.No. : | Pkdcc-2319M |
Product Overview : | Recombinant Mouse Pkdcc protein(Q5RJI4)(33-492aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 33-492aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | PRPGQSPGSSAAPGPGRRGGRGELARQIRERYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLQRPRPPRVRSPPDGAPGWPPAPGPGSPGPGPRLGCAALRNVSGAQYVGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGARRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEGIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVNGELKVTDLDDARVEETPCTSSADCTLEFPARNFSLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLETALHLFRSGQYLQNSTSSRAEYQRIPDSAITQEDYRCWPSYHHGGCLLSVFNLAEAIDVCESHAQCRAFVVTNQTTWTGRKLVFFKTGWNQVVPDAGKTTYVKAPG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pkdcc protein kinase domain containing, cytoplasmic [ Mus musculus ] |
Official Symbol | Pkdcc |
Synonyms | PKDCC; protein kinase domain containing, cytoplasmic; protein kinase domain-containing protein, cytoplasmic; sugen kinase 493; vertebrate lonesome kinase; protein kinase-like protein SgK493; Vlk; MAd1; Adtk1; ESTM17; Sgk493; X83346; AI115348; AW548124; MGC99930; |
Gene ID | 106522 |
mRNA Refseq | NM_134117 |
Protein Refseq | NP_598878 |
◆ Recombinant Proteins | ||
Pkdcc-5788M | Recombinant Mouse Pkdcc protein, His-tagged | +Inquiry |
PKDCC-01H | Recombinant Human PKDCC Protein, GST-tagged | +Inquiry |
PKDCC-12863M | Recombinant Mouse PKDCC Protein | +Inquiry |
PKDCC-5940HF | Recombinant Full Length Human PKDCC Protein, GST-tagged | +Inquiry |
PKDCC-4745H | Recombinant Human PKDCC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKDCC-1025HCL | Recombinant Human PKDCC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pkdcc Products
Required fields are marked with *
My Review for All Pkdcc Products
Required fields are marked with *
0
Inquiry Basket