Recombinant Full Length Human PKDCC Protein, GST-tagged

Cat.No. : PKDCC-5940HF
Product Overview : Human LOC91461 full-length ORF ( NP_612379.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 294 amino acids
Description : PKDCC (Protein Kinase Domain Containing, Cytoplasmic) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and non-membrane spanning protein tyrosine kinase activity.
Molecular Mass : 59.7 kDa
AA Sequence : MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PKDCC protein kinase domain containing, cytoplasmic [ Homo sapiens (human) ]
Official Symbol PKDCC
Synonyms PKDCC; protein kinase domain containing, cytoplasmic; Vlk; SGK493; extracellular tyrosine-protein kinase PKDCC; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; protein kinase-like protein SgK493; sugen kinase 493; vertebrate lonesome kinase; EC 2.7.10.2
Gene ID 91461
mRNA Refseq NM_138370
Protein Refseq NP_612379
MIM 614150
UniProt ID Q504Y2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PKDCC Products

Required fields are marked with *

My Review for All PKDCC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon