Recombinant Human PKDCC Protein, GST-tagged

• Cat.No.: PKDCC-4745H
• Product Overview: Human LOC91461 full-length ORF ( NP_612379.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PKDCC (Protein Kinase Domain Containing, Cytoplasmic) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and non-membrane spanning protein tyrosine kinase activity.
• Molecular Mass: 59.7 kDa
• AA Sequence: MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PKDCC protein kinase domain containing, cytoplasmic [ Homo sapiens (human) ]
• Official Symbol: PKDCC
• Synonyms: PKDCC; protein kinase domain containing, cytoplasmic; Vlk; SGK493; extracellular tyrosine-protein kinase PKDCC; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; protein kinase-like protein SgK493; sugen kinase 493; vertebrate lonesome kinase; EC 2.7.10.2
• Gene ID: 91461
• mRNA Refseq: NM_138370
• Protein Refseq: NP_612379
• MIM: 614150
• UniProt ID: Q504Y2