Recombinant Mouse Pde5a protein, His&Myc-tagged
Cat.No. : | Pde5a-4612M |
Product Overview : | Recombinant Mouse Pde5a protein(Q8CG03)(154-320aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 154-320aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.1 kDa |
AA Sequence : | DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Pde5a phosphodiesterase 5A, cGMP-specific [ Mus musculus ] |
Official Symbol | Pde5a |
Synonyms | PDE5A; phosphodiesterase 5A, cGMP-specific; cGMP-specific 3,5-cyclic phosphodiesterase; CGB-PDE; cGMP-binding cGMP-specific phosphodiesterase; cGMP-binding/cGMP-specific phosphodiesterase; Cn5n; Pde5; Cgbpde; Pde5a1; |
Gene ID | 242202 |
mRNA Refseq | NM_153422 |
Protein Refseq | NP_700471 |
◆ Recombinant Proteins | ||
PDE5A-3994R | Recombinant Rat PDE5A Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE5A-2039H | Recombinant Human PDE5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDE5A-476H | Recombinant Human PDE5A, His-tagged | +Inquiry |
PDE5A-479H | Recombinant Human PDE5A, GST-tagged, Active | +Inquiry |
PDE5A-640B | Recombinant Bovine Phosphodiesterase 5A, cGMP-specific | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE5A-3348HCL | Recombinant Human PDE5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pde5a Products
Required fields are marked with *
My Review for All Pde5a Products
Required fields are marked with *
0
Inquiry Basket