Recombinant Mouse Nkx3-2 protein

• Cat.No.: Nkx3-2-3278M
• Product Overview: Recombinant Mouse Nkx3-2 protein(P97503)(1-333aa) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• ProteinLength: 1-333aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.2 kDa
• AA Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Nkx3-2 NK3 homeobox 2 [ Mus musculus ]
• Official Symbol: Nkx3-2
• Synonyms: NKX3-2; NK3 homeobox 2; homeobox protein Nkx-3.2; homeodomain protein Nkx-3.2; bagpipe homeobox gene 1 homolog; homeobox protein NK-3 homolog B; bagpipe homeobox protein homolog 1; Bapx1; NKX3.2; Nkx-3.2
• Gene ID: 12020
• mRNA Refseq: NM_007524
• Protein Refseq: NP_031550