Recombinant Mouse NKX3-2 Protein (1-333 aa), His-SUMO-tagged

• Cat.No.: NKX3-2-2159M
• Product Overview: Recombinant Mouse NKX3-2 Protein (1-333 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-333 aa
• Description: Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.7 kDa
• AA Sequence: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Nkx3-2 NK3 homeobox 2 [ Mus musculus ]
• Official Symbol: NKX3-2
• Synonyms: NKX3-2; NK3 homeobox 2; homeobox protein Nkx-3.2; Bapx1; NKX3.2; Nkx-3.2
• Gene ID: 12020
• mRNA Refseq: NM_007524
• Protein Refseq: NP_031550
• UniProt ID: P97503