Recombinant Mouse neuregulin 4 Protein, His tagged

• Cat.No.: Nrg4-02M
• Product Overview: Recombinant Mouse Nrg4 Protein with C-His tag was expressed in E. coli.

Specification

• Description: Enables receptor ligand activity. Involved in ERBB4-ERBB4 signaling pathway. Is active in extracellular space. Is expressed in several structures, including embryo mesenchyme; integumental system; pancreas; surface ectoderm; and uterus. Orthologous to human NRG4 (neuregulin 4).
• Source: E. coli
• Species: Mouse
• Tag: C-His
• Protein length: 1-62 aa
• Molecular Mass: 8 kDa
• AA Sequence: MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIPSESNLSHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 95% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Lyophilized from Sterile PBS, pH7.4, 0.1% SKL, 5% Trehalose, 5% Mannitol
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.1 mg/mL. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.

Gene Information

• Gene Name: Nrg4 neuregulin 4 [ Mus musculus (house mouse) ]
• Official Symbol: Nrg4
• Synonyms: NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; pro-NRG4; AI552600
• Gene ID: 83961
• mRNA Refseq: NM_032002
• Protein Refseq: NP_114391
• UniProt ID: Q9WTX4