Recombinant Human NRG4 Protein, His-tagged

• Cat.No.: NRG4-825H
• Product Overview: Recombinant human NRG4 protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 115
• Description: The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation.
• Form: Lyophilized
• Molecular Mass: 8.6 kDa
• AA Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
• Purity: > 98%
• Applications: Migration Assay
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: NRG4 neuregulin 4 [ Homo sapiens (human) ]
• Official Symbol: NRG4
• Synonyms: NRG4; neuregulin 4; pro-neuregulin-4, membrane-bound isoform; HRG4; pro-NRG4; heregulin 4; DKFZp779N0541; DKFZp779N1944
• Gene ID: 145957
• mRNA Refseq: NM_138573
• Protein Refseq: NP_612640
• MIM: 610894
• UniProt ID: Q8WWG1