Recombinant Mouse Napsa protein, His-tagged

• Cat.No.: Napsa-4643M
• Product Overview: Recombinant Mouse Napsa protein(O09043)(73-394aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: His
• Protein length: 73-394aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.5 kDa
• AASequence: YFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNGTKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPTLAVGGVQPPLDAMVEQGLLEKPVFSFYLNRDSEGSDGGELVLGGSDPAHYVPPLTFIPVTIPAYWQVHMESVKVGTGLSLCAQGCSAILDTGTSLITGPSEEIRALNKAIGGYPFLNGQYFIQCSKTPTLPPVSFHLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIPKPAGPLWILGDVFLGPYVAVFDRGDKNVGPRVGLA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Napsa napsin A aspartic peptidase [ Mus musculus ]
• Official Symbol: Napsa
• Synonyms: NAPSA; napsin A aspartic peptidase; napsin-A; KDAP-1; kidney-derived aspartic protease-like protein; KAP; Kdap; NAP1; SNAPA; pronapsin
• Gene ID: 16541
• mRNA Refseq: NM_008437
• Protein Refseq: NP_032463