Recombinant Mouse Napsa protein, His-tagged
Cat.No. : | Napsa-4643M |
Product Overview : | Recombinant Mouse Napsa protein(O09043)(73-394aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 73-394aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | YFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNGTKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPTLAVGGVQPPLDAMVEQGLLEKPVFSFYLNRDSEGSDGGELVLGGSDPAHYVPPLTFIPVTIPAYWQVHMESVKVGTGLSLCAQGCSAILDTGTSLITGPSEEIRALNKAIGGYPFLNGQYFIQCSKTPTLPPVSFHLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIPKPAGPLWILGDVFLGPYVAVFDRGDKNVGPRVGLA |
Gene Name | Napsa napsin A aspartic peptidase [ Mus musculus ] |
Official Symbol | Napsa |
Synonyms | NAPSA; napsin A aspartic peptidase; napsin-A; KDAP-1; kidney-derived aspartic protease-like protein; KAP; Kdap; NAP1; SNAPA; pronapsin; |
Gene ID | 16541 |
mRNA Refseq | NM_008437 |
Protein Refseq | NP_032463 |
◆ Recombinant Proteins | ||
NAPSA-5909M | Recombinant Mouse NAPSA Protein, His (Fc)-Avi-tagged | +Inquiry |
NAPSA-10427M | Recombinant Mouse NAPSA Protein | +Inquiry |
NAPSA-1182H | Recombinant Human NAPSA, His-tagged | +Inquiry |
Napsa-4643M | Recombinant Mouse Napsa protein, His-tagged | +Inquiry |
NAPSA-3262H | Recombinant Human NAPSA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPSA-3969HCL | Recombinant Human NAPSA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Napsa Products
Required fields are marked with *
My Review for All Napsa Products
Required fields are marked with *
0
Inquiry Basket