Recombinant Human NAPSA protein, His-tagged

• Cat.No.: NAPSA-3262H
• Product Overview: Recombinant Human NAPSA protein(O96009)(64-420aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 64-420aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.5 kDa
• AA Sequence: KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: NAPSA napsin A aspartic peptidase [ Homo sapiens ]
• Official Symbol: NAPSA
• Synonyms: NAPSA; napsin A aspartic peptidase; napsin-A; KAP; Kdap; kidney derived aspartic protease like protein; NAP1; NAPA; ASP4; asp 4; napsin-1; TA01/TA02; pronapsin A; aspartyl protease 4; kidney-derived aspartic protease-like protein; SNAPA
• Gene ID: 9476
• mRNA Refseq: NM_004851
• Protein Refseq: NP_004842
• MIM: 605631
• UniProt ID: O96009