Recombinant Mouse Myc, Arg-tagged
Cat.No. : | Myc-71M |
Product Overview : | Recombinant Mouse c-Myc-polyR is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ala439) of Mouse c-Myc fused with a poly-Arginine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 1-439 a.a. |
AA Sequence : | MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSR RSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNII IQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVV FPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVLHEETPPTTSSDSEEEQEDEE EIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRA KLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKA PKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKHKLEQLRNSGA |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | Myc myelocytomatosis oncogene [ Mus musculus ] |
Official Symbol | Myc |
Synonyms | MYC; myelocytomatosis oncogene; myc proto-oncogene protein; c-myc proto-oncogene; transcription factor p64; Myc2; Nird; Niard; bHLHe39; AU016757; |
Gene ID | 17869 |
mRNA Refseq | NM_001177352 |
Protein Refseq | NP_001170823 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Apoptosis, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; |
Function | DNA binding; DNA binding; E-box binding; double-stranded DNA binding; protein binding; protein complex binding; protein heterodimerization activity; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; |
◆ Recombinant Proteins | ||
MYC-2916R | Recombinant Rhesus monkey MYC Protein, His-tagged | +Inquiry |
MYC-060H | Recombinant Human MYC Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYC-5787H | Recombinant Human MYC Protein, GST-tagged | +Inquiry |
MYC-2735R | Recombinant Rhesus Macaque MYC Protein, His (Fc)-Avi-tagged | +Inquiry |
MYC-3839R | Recombinant Rat MYC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Myc Products
Required fields are marked with *
My Review for All Myc Products
Required fields are marked with *
0
Inquiry Basket