Recombinant Mouse Ms4a1 protein, His-tagged
Cat.No. : | Ms4a1-4896M |
Product Overview : | Recombinant Mouse Ms4a1(111-291aa) fused with His tag was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 111-291aa |
Molecular Mass : | 22.3kD |
AA Sequence : | VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVF LGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEI IPVQEEEEEEAEINFPAPPQEQESLPVENEIAP |
Gene Name | Ms4a1 membrane-spanning 4-domains, subfamily A, member 1 [ Mus musculus ] |
Official Symbol | Ms4a1 |
Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B-lymphocyte antigen CD20; CD20 antigen; lymphocyte antigen 44; B-cell differentiation antigen Ly-44; membrane-spanning 4-domains, subfamily A, member 2; Cd20; Ly-44; Ms4a2; AA960661; |
Gene ID | 12482 |
mRNA Refseq | NM_007641 |
Protein Refseq | NP_031667 |
MIM | |
UniProt ID | P19437 |
Chromosome Location | 19 8.19 cM; 19 B |
Pathway | Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | epidermal growth factor receptor binding; |
◆ Recombinant Proteins | ||
MS4A1-16H | Recombinant Human MS4A1, His-tagged | +Inquiry |
Ms4a1-830M | Recombinant Mouse Ms4a1 Protein, MYC/DDK-tagged | +Inquiry |
MS4A1-10113M | Recombinant Mouse MS4A1 Protein | +Inquiry |
MS4A1-0157H | Recombinant Human MS4A1 Protein (T2-P297 end), Flag, 8×His tagged | +Inquiry |
RFL14830HF | Recombinant Full Length Human B-Lymphocyte Antigen Cd20(Ms4A1)-Vlps (Active) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ms4a1 Products
Required fields are marked with *
My Review for All Ms4a1 Products
Required fields are marked with *
0
Inquiry Basket