Recombinant Full Length Mouse B-Lymphocyte Antigen Cd20(Ms4A1) Protein, His-Tagged

• Cat.No.: RFL3192MF
• Product Overview: Recombinant Full Length Mouse B-lymphocyte antigen CD20(Ms4a1) Protein (P19437) (1-291aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mus musculus
• Source: E.coli
• Tag: His
• Protein Length: Full Length (1-291)
• Form: Lyophilized powder
• AA Sequence: MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLG GLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFA AISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSI QSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEI IELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Ms4a1
• Synonyms: Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20
• UniProt ID: P19437