Recombinant Mouse Mc1r Full Length Transmembrane Protein(1-315aa), His-tagged(VLPs)
Cat.No. : | Mc1r-0183M |
Product Overview : | Recombinant Mouse Mc1r Protein(1-315aa)(Q01727), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-315aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.6 kDa |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
AA Sequence : | MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW |
Gene Name | Mc1r melanocortin 1 receptor [ Mus musculus ] |
Official Symbol | Mc1r |
Synonyms | MC1R; melanocortin 1 receptor; melanocyte-stimulating hormone receptor; MC1-R; MSH-R; tobacco darkening; melanocortin receptor 1; melanocortin-1 receptor; extension recessive yellow; e; Tob; Mshra |
Gene ID | 17199 |
mRNA Refseq | NM_008559 |
Protein Refseq | NP_032585 |
◆ Cell & Tissue Lysates | ||
MC1R-4434HCL | Recombinant Human MC1R 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mc1r Products
Required fields are marked with *
My Review for All Mc1r Products
Required fields are marked with *
0
Inquiry Basket