Recombinant Mouse Mc1r Full Length Transmembrane Protein(1-315aa), His-tagged(VLPs)

• Cat.No.: Mc1r-0183M
• Product Overview: Recombinant Mouse Mc1r Protein(1-315aa)(Q01727), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Mouse
• Tag: His
• Protein length: 1-315aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.6 kDa
• AASequence: MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Mc1r melanocortin 1 receptor [ Mus musculus ]
• Official Symbol: Mc1r
• Synonyms: MC1R; melanocortin 1 receptor; melanocyte-stimulating hormone receptor; MC1-R; MSH-R; tobacco darkening; melanocortin receptor 1; melanocortin-1 receptor; extension recessive yellow; e; Tob; Mshra
• Gene ID: 17199
• mRNA Refseq: NM_008559
• Protein Refseq: NP_032585