Recombinant Mouse Mbp protein, His-tagged
Cat.No. : | Mbp-644M |
Product Overview : | Recombinant Mouse Mbp protein(P04370)(1-250aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-250aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR |
Gene Name | Mbp myelin basic protein [ Mus musculus ] |
Official Symbol | Mbp |
Synonyms | MBP; myelin basic protein; Golli-Mbp; myelin basic protein; shiverer; myelin deficient; myelin A1 protein; mld; shi; Hmbpr; C76307; R75289; golli-mbp; |
Gene ID | 17196 |
mRNA Refseq | NM_001025245 |
Protein Refseq | NP_001020416 |
◆ Recombinant Proteins | ||
MBP-6949B | Bovine Myelin basic protein, Biotin-Conjugated | +Inquiry |
Mbp-2765M | Recombinant Mouse Mbp protein, His & T7-tagged | +Inquiry |
MBP-2755P | Recombinant Pan-species (General) MBP Protein, His/MBP-tagged | +Inquiry |
MBP-6947H | Human Myelin basic protein | +Inquiry |
MBP-2915HFL | Recombinant Full Length Human MBP protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
MBP-99S | Native Swine MBP | +Inquiry |
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBP-4437HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4436HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
MBP-4438HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mbp Products
Required fields are marked with *
My Review for All Mbp Products
Required fields are marked with *
0
Inquiry Basket