Recombinant Mouse Mbp protein, His-tagged

• Cat.No.: Mbp-644M
• Product Overview: Recombinant Mouse Mbp protein(P04370)(1-250aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 1-250aa
• Tag: N-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.2 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR

Gene Information

• Gene Name: Mbp myelin basic protein [ Mus musculus ]
• Official Symbol: Mbp
• Synonyms: MBP; myelin basic protein; Golli-Mbp; myelin basic protein; shiverer; myelin deficient; myelin A1 protein; mld; shi; Hmbpr; C76307; R75289; golli-mbp
• Gene ID: 17196
• mRNA Refseq: NM_001025245
• Protein Refseq: NP_001020416