Recombinant Mouse Lypla1 Protein, His-tagged
Cat.No. : | Lypla1-7304M |
Product Overview : | Recombinant mouse LYPLA1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-230 |
Description : | Acts as a acyl-protein thioesterase hydrolyzing fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Could also depalmitoylate ADRB2. Acts as a lysophospholipase hydrolyzing various lysophospholipids including lysophosphatidylcholine (lyso-PC), lysophosphatidylethanolamine (lyso-PE), lysophosphatidylinositol (lyso-PI) and lysophosphatidylserine (lyso-PS). Has much higher thioesterase activity than lysophospholipase activity. Contributes to the production of lysophosphatidic acid (LPA) during blood coagulation by recognizing and cleaving plasma phospholipids to generate lysophospholipids which in turn act as substrates for ENPP2 to produce LPA. |
Form : | Liquid |
Molecular Mass : | 26.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol, 0.1 M NaCl, 1 mM DTT |
Gene Name | Lypla1 lysophospholipase 1 [ Mus musculus (house mouse) ] |
Official Symbol | Lypla1 |
Synonyms | Lypla1; lysophospholipase 1; P; APT-1; LPL-I; Pla1a; Gm39587; acyl-protein thioesterase 1; lysoPLA I; lysophopholipase 1; lysophospholipase I; phospholipase 1a; EC 3.1.1.5 |
Gene ID | 18777 |
mRNA Refseq | NM_001355712 |
Protein Refseq | NP_001342641 |
UniProt ID | P97823 |
◆ Recombinant Proteins | ||
LYPLA1-2387Z | Recombinant Zebrafish LYPLA1 | +Inquiry |
Lypla1-7304M | Recombinant Mouse Lypla1 Protein, His-tagged | +Inquiry |
LYPLA1-3173R | Recombinant Rat LYPLA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYPLA1-3517R | Recombinant Rat LYPLA1 Protein | +Inquiry |
Lypla1-2813M | Recombinant Mouse Lysophospholipase 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPLA1-4589HCL | Recombinant Human LYPLA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lypla1 Products
Required fields are marked with *
My Review for All Lypla1 Products
Required fields are marked with *
0
Inquiry Basket