Recombinant Mouse Lrpap1 protein, GFP-tagged

• Cat.No.: Lrpap1-5744M
• Product Overview: Recombinant Mouse Lrpap1 protein(P55302)(248-360aa(H294F,H296F,Y297C,H305F)), fused with N-terminal GFP tag, was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: GFP
• Protein Length: 248-360aa(H294F,H296F,Y297C,H305F)
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Gene Information

• Gene Name: Lrpap1 low density lipoprotein receptor-related protein associated protein 1 [ Mus musculus ]
• Official Symbol: Lrpap1
• Synonyms: LRPAP1; low density lipoprotein receptor-related protein associated protein 1; alpha-2-macroglobulin receptor-associated protein; HBP-44; alpha-2-MRAP; heparin-binding protein 44; low density lipoprotein receptor-related protein-associated protein 1; low density lipoprotein receptor related protein, associated protein 1; Alpha-2-macroglobulin receptor-associated protein precursor (Alpha-2-MRAP) (Low density lipoprotein receptor-related protein-associated protein 1) (RAP) (Heparin binding protein-44) (HBP-44); RAP; HBP44; C77774; AA617339; AI790446; AU042172
• Gene ID: 16976
• mRNA Refseq: NM_013587
• Protein Refseq: NP_038615