Recombinant Mouse Lgals7 Protein, His-tagged
Cat.No. : | Lgals7-7263M |
Product Overview : | Recombinant Mouse Lgals7 protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-136 |
Description : | Biased expression in stomach adult (RPKM 383.9), lung adult (RPKM 28.9) and 1 other tissue. |
Form : | Liquid |
Molecular Mass : | 17.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMSATQHKTSLPQGVRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGREERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDVQLHSVKIF |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 20 % glycerol, 2 mM DTT |
Gene Name | Lgals7 lectin, galactose binding, soluble 7 [ Mus musculus (house mouse) ] |
Official Symbol | Lgals7 |
Synonyms | Lgals7; lectin, galactose binding, soluble 7; Pi; Pig1; Galect; Galectin-7; galectin-7; gal-7 |
Gene ID | 16858 |
mRNA Refseq | NM_008496 |
Protein Refseq | NP_032522 |
UniProt ID | Q9CRB1 |
◆ Recombinant Proteins | ||
Lgals7-7191M | Recombinant Mouse Lectin, Galactose Binding, Soluble 7, His-tagged | +Inquiry |
Lgals7-427R | Recombinant Rat Lgals7 Protein, His-tagged | +Inquiry |
Lgals7-7263M | Recombinant Mouse Lgals7 Protein, His-tagged | +Inquiry |
LGALS7-3623H | Recombinant Human LGALS7 | +Inquiry |
LGALS7-4263H | Recombinant Human LGALS7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lgals7 Products
Required fields are marked with *
My Review for All Lgals7 Products
Required fields are marked with *
0
Inquiry Basket