Recombinant Mouse Lgals7 Protein, His-tagged

• Cat.No.: Lgals7-7263M
• Product Overview: Recombinant Mouse Lgals7 protein with a His tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-136
• Description: Biased expression in stomach adult (RPKM 383.9), lung adult (RPKM 28.9) and 1 other tissue.
• Form: Liquid
• Molecular Mass: 17.6 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMSATQHKTSLPQGVRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKEQGKWGREERGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRLVEVGGDVQLHSVKIF
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 20 % glycerol, 2 mM DTT

Gene Information

• Gene Name: Lgals7 lectin, galactose binding, soluble 7 [ Mus musculus (house mouse) ]
• Official Symbol: Lgals7
• Synonyms: Lgals7; lectin, galactose binding, soluble 7; Pi; Pig1; Galect; Galectin-7; galectin-7; gal-7
• Gene ID: 16858
• mRNA Refseq: NM_008496
• Protein Refseq: NP_032522
• UniProt ID: Q9CRB1