Recombinant Human LGALS7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LGALS7-4263H
• Product Overview: LGALS7 MS Standard C13 and N15-labeled recombinant protein (NP_002298) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.9 kDa
• AA Sequence: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LGALS7 galectin 7 [ Homo sapiens (human) ]
• Official Symbol: LGALS7
• Synonyms: LGALS7; lectin, galactoside-binding, soluble, 7; galectin-7; GAL7; galectin 7; LGALS7A; PIG1; TP53I1
• Gene ID: 3963
• mRNA Refseq: NM_002307
• Protein Refseq: NP_002298
• MIM: 600615
• UniProt ID: P47929