Recombinant Mouse Lgals4 Protein, His-tagged

• Cat.No.: Lgals4-263M
• Product Overview: Recombinant Mouse Lgals4 protein with His tag was expressed in HEK293.

Specification

• Description: Enables galactoside binding activity. Located in extracellular space. Is expressed in several structures, including gonad; gut; heart; liver; and spleen. Orthologous to human LGALS4 (galectin 4).
• Source: HEK293
• Species: Mouse
• Tag: His
• Form: Lyophilized
• Molecular Mass: 38.6 kDa
• Protein length: 326
• AA Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus (house mouse) ]
• Official Symbol: Lgals4
• Synonyms: LGALS4; lectin, galactose binding, soluble 4; galectin-4; lactose-binding lectin 4; gal-4
• Gene ID: 16855
• mRNA Refseq: NM_010706
• Protein Refseq: NP_034836
• UniProt ID: Q8K419