Recombinant Active Human LGALS4 Protein, His-tagged(N-ter)
Cat.No. : | LGALS4-229H |
Product Overview : | Recombinant Active Human LGALS4 Protein with His tag (N-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 8 μg/mL. |
AA Sequence : | AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 7.4) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | LGALS4 lectin, galactoside-binding, soluble, 4 [ Homo sapiens ] |
Official Symbol | LGALS4 |
Synonyms | LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; GAL4; galectin 4; gal-4; antigen NY-CO-27; lactose-binding lectin 4; L-36 lactose-binding protein; L36LBP; |
Gene ID | 3960 |
mRNA Refseq | NM_006149 |
Protein Refseq | NP_006140 |
MIM | 602518 |
UniProt ID | P56470 |
◆ Recombinant Proteins | ||
LGALS4-326M | Recombinant Mouse LGALS4 protein, His-tagged | +Inquiry |
Lgals4-3167R | Recombinant Rat Lgals4 protein, His-SUMO-tagged | +Inquiry |
LGALS4-262H | Recombinant Human LGALS4 Protein, His-tagged | +Inquiry |
LGALS4-28965TH | Recombinant Human LGALS4, His-tagged | +Inquiry |
LGALS4-3045R | Recombinant Rat LGALS4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALS4 Products
Required fields are marked with *
My Review for All LGALS4 Products
Required fields are marked with *
0
Inquiry Basket