Recombinant Active Human LGALS4 Protein, His-tagged(N-ter)

• Cat.No.: LGALS4-229H
• Product Overview: Recombinant Active Human LGALS4 Protein with His tag (N-ter) was expressed in E. coli.

Specification

• Description: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Powder
• Bio-activity: Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 8 μg/mL.
• AA Sequence: AYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: LGALS4 lectin, galactoside-binding, soluble, 4 [ Homo sapiens ]
• Official Symbol: LGALS4
• Synonyms: LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; GAL4; galectin 4; gal-4; antigen NY-CO-27; lactose-binding lectin 4; L-36 lactose-binding protein; L36LBP
• Gene ID: 3960
• mRNA Refseq: NM_006149
• Protein Refseq: NP_006140
• MIM: 602518
• UniProt ID: P56470