Recombinant Mouse Klk14 protein, His-tagged

• Cat.No.: Klk14-4610M
• Product Overview: Recombinant Mouse Klk14 protein(Q8CGR5)(24-250aa), fused to N-terminal His tag, was expressed in E. coli

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 24-250aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.5 kDa
• AA Sequence: IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Klk14 kallikrein related-peptidase 14 [ Mus musculus ]
• Official Symbol: Klk14
• Synonyms: KLK14; kallikrein related-peptidase 14; kallikrein-14; mGK14; kallikrein 14; glandular kallikrein KLK14; GK14; MGC157618
• Gene ID: 317653
• mRNA Refseq: NM_174866
• Protein Refseq: NP_777355