Recombinant Mouse Kitl Protein

• Cat.No.: Kitl-7284M
• Product Overview: Recombinant Mouse Kitl Protein without tag was expressed in E. coli.

Specification

• Description: Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
• Source: E. coli
• Species: Mouse
• Form: Liquid
• Molecular Mass: 18 kDa
• Protein length: 26-189
• AA Sequence: MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate buffer saline (pH 7.4) containing 10 % glycerol

Gene Information

• Gene Name: Kitl kit ligand [ Mus musculus (house mouse) ]
• Official Symbol: Kitl
• Synonyms: Kitl; kit ligand; S; Gb; SC; SF; Sl; bl; Clo; Con; Kit; Mgf; SCF; SLF; Ste; blz; Kitlg; contrasted; kit ligand; C-kit ligand; Steel factor; cloud gray; grizzle-belly; hematopoietic growth factor KL; mast cell growth factor; stem cell factor; EC 3.2.1.31
• Gene ID: 17311
• mRNA Refseq: NM_001347156
• Protein Refseq: NP_001334085
• UniProt ID: P20826