Recombinant Mouse Isg15 protein, His-tagged

• Cat.No.: Isg15-4633M
• Product Overview: Recombinant Mouse Isg15 protein(Q64339)(1-155aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Mouse
• Tag: C-His
• Protein length: 1-155aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.2 kDa
• AASequence: MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Isg15 ISG15 ubiquitin-like modifier [ Mus musculus ]
• Official Symbol: Isg15
• Synonyms: ISG15; ISG15 ubiquitin-like modifier; ubiquitin-like protein ISG15; interferon-stimulated protein 15; ubiquitin cross-reactive protein; interferon-induced 15 kDa protein; interferon-induced 15-KDa protein; interferon-induced 17 kDa protein; interferon, alpha-inducible protein; interferon-stimulated protein (15 kDa); G1p2; IP17; Irfp; UCRP; IGI15; MGC18616; MGC103144; MGC130321
• Gene ID: 100038882
• mRNA Refseq: NM_015783
• Protein Refseq: NP_056598