Recombinant Human ISG15 Protein, GST-tagged
Cat.No. : | ISG15-987H |
Product Overview : | Recombinant Human ISG15 Protein(NP_005092.1)(1-165 aa) is expressed from E. coli with a GST Tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-165 aa |
Description : | The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested. |
AA Sequence : | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Applications : | Blocking peptide |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | ISG15 |
Official Symbol | ISG15 |
Synonyms | G1P2; IFI15; UCRP |
Gene ID | 9636 |
mRNA Refseq | NM_005101.4 |
Protein Refseq | NP_005092.1 |
MIM | 147571 |
UniProt ID | P05161 |
◆ Recombinant Proteins | ||
ISG15-191H | Recombinant Human ISG15 protein(Met1-Gly157) | +Inquiry |
ISG15-431M | Recombinant Mouse ISG15 Protein, His-GFP-tagged | +Inquiry |
ISG15-931HFL | Recombinant Full Length Human ISG15 Protein, C-Flag-tagged | +Inquiry |
Isg15-009M | Recombinant Mouse Isg15 Protein, MYC/DDK-tagged | +Inquiry |
Isg15-3120H | Recombinant Human Isg15 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISG15-5152HCL | Recombinant Human ISG15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISG15 Products
Required fields are marked with *
My Review for All ISG15 Products
Required fields are marked with *
0
Inquiry Basket