Recombinant Mouse Il9r protein, His-tagged

• Cat.No.: Il9r-7074H
• Product Overview: Recombinant Mouse Il9r protein(NP_001127930.1)(Gly47~Gln257) fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: Gly47~Gln257
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
• Molecular Mass: 29kDa as determined by SDS-PAGE reducing conditions.
• AA Sequence: GQKAGAFTCLSNSIYRIDCHWSAPELGQESRAWLLFTSNQVTEIKHKCTFWDSMCTLVLPKEEVFLPFDNFTITLHRCIMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGINLALEPLITSLSYELAFKRQEEAWEARHKDRIVGVTWLILEAVELNPGSIYEARLRVQMTLESYEDKTEGEYYKSHWSEWSQPVSFPSPQ
• Endotoxin: <1.0EU per 1µg (determined by the LAL method).
• Purity: >95% as determined by SDS-PAGE.
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
• Concentration: 200µg/ml
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: Il9r
• Official Symbol: Il9r
• Synonyms: CD129; IL9-R; Cluster Of Differentiation 129
• Gene ID: 16199
• mRNA Refseq: NM_001134458.1
• Protein Refseq: NP_001127930.1
• UniProt ID: Q01114