Recombinant Mouse Il9r protein, His-tagged

Cat.No. : Il9r-7074H
Product Overview : Recombinant Mouse Il9r protein(NP_001127930.1)(Gly47~Gln257) fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : Gly47~Gln257
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 29kDa as determined by SDS-PAGE reducing conditions.
AA Sequence : GQKAGAFTCLSNSIYRIDCHWSAPELGQESRAWLLFTSNQVTEIKHKCTFWDSMCTLVLPKEEVFLPFDNFTITLHRCIMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGINLALEPLITSLSYELAFKRQEEAWEARHKDRIVGVTWLILEAVELNPGSIYEARLRVQMTLESYEDKTEGEYYKSHWSEWSQPVSFPSPQ
Endotoxin : <1.0EU per 1µg (determined by the LAL method).
Purity : >95% as determined by SDS-PAGE.
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
If bio-activity of the protein is needed, please check active protein.
Notes : The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Concentration : 200µg/ml
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name Il9r
Official Symbol Il9r
Synonyms CD129; IL9-R; Cluster Of Differentiation 129
Gene ID 16199
mRNA Refseq NM_001134458.1
Protein Refseq NP_001127930.1
UniProt ID Q01114

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Il9r Products

Required fields are marked with *

My Review for All Il9r Products

Required fields are marked with *

0

Inquiry Basket

cartIcon