Recombinant Human IL9R Protein, C-His-tagged
Cat.No. : | IL9R-072H |
Product Overview : | Recombinant Human IL9R Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-9 (IL-9) functions to support the growth of helper T cells, megakaryoblastic leukemia cells, fetal thymocytes, erythroid and myeloid precursors and mast cells. The murine IL-9 receptor has been identified as a protein expressed on a T cell clone. Both the murine and human IL-9 receptor cDNAs have been isolated by expression cloning from the murine T cell clone TS1 and the human megakaryoblastic leukemia cell line MO7E, respectively. In addition, the cloning and analysis of the complete human IL-9 receptor genomic DNA has been reported. In this latter study, the IL-9R gene was shown to consist of 10 exons expressed over approximately 13.7 kb of DNA. |
Molecular Mass : | ~25 kDa |
AA Sequence : | SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | IL9R interleukin 9 receptor [ Homo sapiens (human) ] |
Official Symbol | IL9R |
Synonyms | IL9R; interleukin 9 receptor; interleukin-9 receptor; CD129; IL-9R; IL-9 receptor; |
Gene ID | 3581 |
mRNA Refseq | NM_002186 |
Protein Refseq | NP_002177 |
MIM | 300007 |
UniProt ID | Q01113 |
◆ Recombinant Proteins | ||
IL9R-5164H | Recombinant Human IL9R protein(Ser41-Pro270), Fc-tagged | +Inquiry |
IL9R-1074R | Active Recombinant Rat IL9R protein(Met1-Ala270), His-tagged | +Inquiry |
IL9R-3106H | Recombinant Human IL9R Protein (Ser115-Pro230), His tagged | +Inquiry |
Il9r-7074H | Recombinant Mouse Il9r protein, His-tagged | +Inquiry |
IL9R-1219H | Recombinant Human IL9R Protein (Ser155-Pro270), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9R-1662RCL | Recombinant Rat IL9R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL9R Products
Required fields are marked with *
My Review for All IL9R Products
Required fields are marked with *
0
Inquiry Basket