Recombinant Human IL9R Protein, C-His-tagged

• Cat.No.: IL9R-072H
• Product Overview: Recombinant Human IL9R Protein with C-His tag was expressed in E. coli.

Specification

• Description: Interleukin-9 (IL-9) functions to support the growth of helper T cells, megakaryoblastic leukemia cells, fetal thymocytes, erythroid and myeloid precursors and mast cells. The murine IL-9 receptor has been identified as a protein expressed on a T cell clone. Both the murine and human IL-9 receptor cDNAs have been isolated by expression cloning from the murine T cell clone TS1 and the human megakaryoblastic leukemia cell line MO7E, respectively. In addition, the cloning and analysis of the complete human IL-9 receptor genomic DNA has been reported. In this latter study, the IL-9R gene was shown to consist of 10 exons expressed over approximately 13.7 kb of DNA.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~25 kDa
• AA Sequence: SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: IL9R interleukin 9 receptor [ Homo sapiens (human) ]
• Official Symbol: IL9R
• Synonyms: IL9R; interleukin 9 receptor; interleukin-9 receptor; CD129; IL-9R; IL-9 receptor
• Gene ID: 3581
• mRNA Refseq: NM_002186
• Protein Refseq: NP_002177
• MIM: 300007
• UniProt ID: Q01113