Recombinant Mouse IL28B protein

• Cat.No.: IL28B-65M
• Product Overview: Recombinant Mouse IL28B protein was expressed in Escherichia coli.

Specification

• Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
• Source: E.coli
• Species: Mouse
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HepG2 cells infected with encephalomyocarditis is less than 30 ng/ml, corresponding to a specific activity of > 3.3 × 10⁴ IU/mg.
• Molecular Mass: Approximately 19.6 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids.
• Protein length: 174
• AA Sequence: DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV
• Endotoxin: Less than 1 EU/µg of rMuIFN-λ3/IL-28B as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: IL28B
• Official Symbol: IL28B
• Synonyms: IL28B; interleukin 28B; interleukin-28B; IFN-lambda-3; interleukin 28; interferon alpha; interferon lambda-3; Il28; IFL-1; IL-28B; INF-alpha; INF-lambda
• Gene ID: 338374
• mRNA Refseq: NM_177396
• Protein Refseq: NP_796370
• UniProt ID: Q8CGK6